DPCstruct | MC38779
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 143 ± 21 aa |
| Standard deviation of domain lengths | 21.38 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 64.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.28 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 31.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06200- CL0281 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A540K867 | 35-184 | ANSSVKKSAPGEPQKAQMTIFYDGQVIVFNDFPADKAKEVMLLASKESSQRHTTPASTPANINNAFASHLGKSPINSSSSVPPSTNM… |
| A0A6A2Z3F3 | 56-155 | LTNPAASENGPETAPLTIFYNGTVSVFNVPRDKVESILKHAVEGVPKNFEATDSKVATPSSDEQQLLETLDGDLPIARRKSLQRFLE… |
| A0A7J7CHI3 | 33-185 | None |
| A0A3Q7EQ67 | 11-132 | None |
| A3C4D8 | 1-134 | None |
| A0A0D6R086 | 172-311 | None |
| A0A251SY00 | 19-136 | None |
| A0A287PQN8 | 11-124 | None |
| A0A7C9DVI2 | 2-119 | None |
| M0ZZ45 | 19-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.