DPCstruct | MC38775
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 256 ± 31 aa |
| Standard deviation of domain lengths | 31.31 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 20.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0U5G8B5 | 120-362 | PMLSTLFTNIDRKVTSEWEIIEQRKAGLGDGDLADEMKSESILRQLTYSAVIMVASLLDPQRGDPDDEPTDPSAPQPLPVLADSIRH… |
| A0A540K4A7 | 1-244 | MEEKLLRDLTREVCSLLAVIASPQLNTGLPSLEHSGHVHRVDVSSLKELDAFASSSMVGFLLNHKGLALPALQICLEAFTWTDGEAM… |
| A0A1D2N4F8 | 809-1039 | None |
| U9U2F5 | 156-382 | None |
| F4P881 | 1-309 | None |
| A0A821LXM0 | 214-513 | None |
| A0A117NPH3 | 1-241 | None |
| A0A6P4Z0V9 | 80-323 | None |
| A0A2D4HY16 | 122-403 | None |
| A0A2C5YM77 | 10-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.