DPCstruct | MC3876
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 132 ± 13 aa |
| Standard deviation of domain lengths | 12.61 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A5GAG2 | 135-258 | VKVTPPLDKGTVARITWIGKQLENCKKKSENVFNKLFDYIWIEANIKYAQVNLKVKLSELSILHELIGGREIQAFHVVLIMDYGVNF… |
| A0A3D9T1Y8 | 1-117 | MDGTALRRASWLLKQLKNAPADILVEAVFADASEVSCENLATVRADTKSLTYGRVSELKRFTLTSPSRMGSKRSGSAAGFIGSVTDG… |
| A0A4V3CBV7 | 107-240 | None |
| A0A3N4RMR4 | 543-649 | None |
| A0A2G4YV41 | 216-337 | None |
| A0A523F8F2 | 337-481 | None |
| A0A1X3P719 | 12-147 | None |
| A0A4R5DEE5 | 239-401 | None |
| A0A848Q4M5 | 72-201 | None |
| A0A2T6NF90 | 1-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.