DPCstruct | MC38759
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 147 ± 34 aa |
| Standard deviation of domain lengths | 33.91 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 76.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15794 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9JZC0 | 106-210 | VKDADGVLCRYKKILGTFQKLKSMSRAFEHHRVDRNTVALTTPIAELLIVAPEKLAEVGEFDPSKERLLEYSRRCFLALDEETLKKV… |
| A0A1S3LU78 | 36-162 | IHPLDRHRVMKSSKRSRDGENTRVRMKNVVGVIARYMAALQEFRRSVSMKVAFDRVGVDRNTISRTAAIAELSLAAPEVFHALPPWD… |
| A0A553MYG6 | 114-277 | None |
| C3ZQF5 | 161-367 | None |
| A0A6I9YH10 | 4-108 | None |
| A0A6P8VHZ9 | 4-123 | None |
| D4AAV8 | 170-337 | None |
| A0A0F8CLD8 | 61-224 | None |
| A0A670ZBT8 | 67-231 | None |
| A0A1A7ZEW2 | 102-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.