DPCstruct | MC38757
Metacluster Properties and Pfam Annotations
| Number of structural domains | 548 |
|---|---|
| Mean domain length (aa) | 168 ± 41 aa |
| Standard deviation of domain lengths | 41.00 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 83.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 28.42 |
| Pfam Score | 96.85 |
| Assigned Pfam label(s) | PF10574- CL0550- PF00095- PF01826- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9B484 | 3-170 | VIQNRFEGTVDFYRGWQDYKHGFGNIGGEFWLGLEKLHLLTNYKVNELFIELQDFTLEKSHAQYSAFAVGSEIEGYPISVLGKYEGA… |
| A0A6P4L769 | 2-151 | ILQEIQIPGSDPFKVVCFSDEKIGSGWMVVYKHWDKTNYFNRTYEEFERGIGDVGTQWDDKYFIGLERLHLLTSRNSYELNIYDTNK… |
| A0A6P4ELC4 | 145-272 | None |
| A0A6P8H935 | 521-713 | None |
| A0A6P4ER51 | 47-214 | None |
| A0A4Z2HKA0 | 537-739 | None |
| A0A6P4EMW1 | 33-138 | None |
| A0A2G8L6S7 | 179-329 | None |
| A0A2G8KZW9 | 16-161 | None |
| A0A2G8L5Z7 | 92-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.