DPCstruct | MC38742
Metacluster Properties and Pfam Annotations
| Number of structural domains | 80 |
|---|---|
| Mean domain length (aa) | 94 ± 10 aa |
| Standard deviation of domain lengths | 10.31 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01312 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T9ICV5 | 259-363 | PKATVVVTNPTHYAVALRYQPGVDRAPTVVAKGADLVAKRIRELATEAGVPLMESPPLARALYAQTEPGDEIPSELYAAVAEIMAVV… |
| C0AUZ2 | 34-132 | RMMADVPNADVIVTNPTHYAVALQYNDKMTAPKVLAKGAGAIALKIKEIGAENRIPLLEAPPLARALYRHSEIGHAIPSTLYAAVAE… |
| A0A439JGZ3 | 92-196 | None |
| A0A1Q3RIG4 | 165-261 | None |
| A0A6I7QV06 | 2-87 | None |
| Y0KH22 | 257-351 | None |
| A0A518CTP3 | 290-387 | None |
| A0A3G2G0G4 | 422-548 | None |
| A0A7C1H423 | 106-200 | None |
| A0A3T0K6G2 | 419-521 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.