DPCstruct | MC38740
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 95 ± 7 aa |
| Standard deviation of domain lengths | 6.86 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 95.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 36.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B1JLF6 | 3-99 | PPLRVVLLARNREGWARLCRITSAAHADALGNRAPVVPWSALREHGGPGLLALLGPLSEPARALSVGREDVAVRLLAPWREVFGPEV… |
| A0A641W6N3 | 132-225 | YHLIVLAKNETGYHNLIKLVSHAWTRGYYMRPRTDRSELEKYHEGLIICSACLGGEVPKRITAGQFAEAEEAIQWYKNLFGDDYYLE… |
| A0A7G3D7R9 | 32-127 | None |
| A0A661HJP5 | 88-187 | None |
| A0A837HY88 | 59-134 | None |
| A0A2C6LKH4 | 3-102 | None |
| A0A4U9WRF8 | 40-141 | None |
| A0A140GS45 | 147-239 | None |
| A0A401FRC7 | 93-187 | None |
| A0A0G0MY57 | 84-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.