DPCstruct | MC38736
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 143 ± 23 aa |
| Standard deviation of domain lengths | 23.39 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 92.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 38.80 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0061- PF03711 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A365VPP6 | 4-177 | WFFSVWGPDNLSEEGIGSRDDWMLKPNDHWHGFGPLAEGFNMLDPIKATIITPGLDVDGEFGETGIPAAIVTKYLAEHGIIVEKTGL… |
| A0A376VFE6 | 46-186 | ILARCKLFRPFIPPVVDGKLWQDYPTSVLASDRRFFSFEPGAKWHGFEGYAADQYFVDPCKLLLTTPGIDAETGEYSDFGVPATILA… |
| A0A377BZR0 | 1-140 | None |
| A0A447TPN5 | 24-162 | None |
| B0E8W5 | 591-701 | None |
| A0A7I8CHL0 | 119-303 | None |
| A0A223RNQ4 | 550-726 | None |
| A0A3P5DHH8 | 52-223 | None |
| A0A6F9EIC1 | 197-299 | None |
| A0A6N8KAJ1 | 1-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.