DPCstruct | MC38732
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 115 ± 15 aa |
| Standard deviation of domain lengths | 14.96 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 44.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12458 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X0QQI1 | 1-145 | MADTQNLTTPDSNDNPNASQASQTDQAVASGNAYELIKKRLTEQGARLEQQTATLNTARLEEFGSTQMQVIARTRIRTEHNCVAQDM… |
| A0A090QS31 | 2-124 | TDTTQNAIDDAVSEGGAYEVLKARLSQQGETLKDLSQQFNLKRQQTFGGSEFSLIGKANVQTDARCIPVDMAQVNGQILFGYHVYVG… |
| A0A090Q2J7 | 12-115 | None |
| X0QYE3 | 7-110 | None |
| A0A379GC42 | 2-132 | None |
| A0A2X2CW13 | 1-129 | None |
| A0A6B3BJD1 | 2-94 | None |
| A0A7C5N2V8 | 16-127 | None |
| A0A3T1DYH9 | 2-122 | None |
| Q9HXR4 | 12-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.