DPCstruct | MC3873
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 200 ± 33 aa |
| Standard deviation of domain lengths | 33.12 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 31.36 |
| Pfam Score | 95.65 |
| Assigned Pfam label(s) | CL0274- CL0705- PF09788 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J2XQ22 | 28-206 | AQRELIDSGKVSRHPISSSDDGQWSEGLISAARLVAAATHSLVESANALVQGLGSEDKLIAAAKQVASSTAHLLVACKVKAEGDTDA… |
| V9IHW2 | 1-131 | MVAAATHSLVESANALVQGVSSEEKLISSAKQVASSTAQLLVACKVKADPDSDSTKRLQAAGNAVKRATDNLVRAAQQAIQQEEDRS… |
| E9HPF1 | 97-299 | None |
| A0A0L7QMW8 | 214-408 | None |
| A0A5K4F0V3 | 512-716 | None |
| A0A369S3A3 | 754-1007 | None |
| A0A834BCH2 | 1-133 | None |
| A0A0K0EJV8 | 2388-2590 | None |
| M2REV3 | 474-698 | None |
| B0ETT5 | 74-300 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.