DPCstruct | MC38729
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 159 ± 25 aa |
| Standard deviation of domain lengths | 24.60 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1N7LW31 | 13-157 | KGPLFVYNGGLMRRPLRQMLAQAGWPLRLGLPRQGDLVGLWGASPTAWRAETIAARRAARLIRFEDAFLRSLHPGRGGGGAPLGLIP… |
| X0Q5K1 | 64-221 | DKPIVIAFGFNDWKFGFIAEYLPQYRVAFAPRKQVDMKAVRLLMGLSIKPKLALIWGYNESKLLGRYLKFIGIDTWRAEDGFVRSAD… |
| X0QXX5 | 238-457 | None |
| A0A376Y550 | 1-112 | None |
| A0A2K4MKR8 | 297-435 | None |
| A0A2E6Y4D8 | 147-295 | None |
| A0A1H2EJS4 | 84-271 | None |
| A0A1I7CU21 | 27-190 | None |
| A0A4Z0NKR1 | 304-478 | None |
| A0A5C4XS40 | 226-380 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.