DPCstruct | MC38728
Metacluster Properties and Pfam Annotations
| Number of structural domains | 195 |
|---|---|
| Mean domain length (aa) | 92 ± 22 aa |
| Standard deviation of domain lengths | 21.87 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 85.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 29.71 |
| Pfam Score | 95.42 |
| Assigned Pfam label(s) | PF00276- CL0221- PF03939- CL0144- PF00573 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F7QN99 | 5-105 | NVVLLPRMSEKAYGVSETLNTYVFDVPLNTSKQSVATAVAEQFEVQVESVNTNTIKGKTKRTYRKSGRGAMGRRSDVKRAYVRVKEG… |
| A0A834F8V8 | 190-271 | RRNKLDHYAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKHAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALD |
| A0A6I9KA48 | 5-78 | None |
| A0A6N2DQV3 | 4-90 | None |
| A0A3Q7T9B6 | 162-243 | None |
| F4PSR1 | 24-103 | None |
| A0A438N4Q8 | 169-283 | None |
| L5JNM2 | 2-57 | None |
| L5JYW0 | 54-126 | None |
| L5KCV5 | 7-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.