DPCstruct | MC38725
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 142 ± 20 aa |
| Standard deviation of domain lengths | 20.38 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 30.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04901 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K5V4M1 | 111-252 | AASSCSWGLPNFSPAHHLFMATACQEANYGALLQELCLTQFQVDMEAVGETLWCDWGRTIGSYRELADCTWHMAEKLGCFWPNAEVD… |
| A0A7J7XW22 | 2-102 | NMEAIGRTLWCDWGKTIESYKELSDCTKYVMDGLNCYWPNAAVNKFFISVHQRYFRSCPVSGRALQDPPISILCPFIVVPILMTLLM… |
| L9JWD1 | 20-159 | None |
| F6X2S0 | 248-399 | None |
| A0A2I4CJZ2 | 141-304 | None |
| A0A7J6CN48 | 1-157 | None |
| H3A928 | 7-143 | None |
| A0A674I483 | 7-124 | None |
| A0A668A9X6 | 38-182 | None |
| A0A3P9J368 | 18-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.