DPCstruct | MC38724
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 61 ± 6 aa |
| Standard deviation of domain lengths | 5.54 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.66 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 68.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00737 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832M2S2 | 2-53 | VLKPLNSEYGKVVPGWGTTPLMAVFMGLFFVFLLIILQIYNSSLILNDFTVD |
| A0A290Y2J5 | 46-108 | KKKSMETTAGSLLKPLNSEYGKVAPGWGTTPFMGVAMALFTIFLSIILEIYNSSVLLDGILTN |
| A0A7J7MLT1 | 1-71 | None |
| A0A5K7W5W5 | 20-83 | None |
| A0A4Y5P3K6 | 2-56 | None |
| A0A6H0DNB9 | 9-73 | None |
| A0A453BU85 | 2-55 | None |
| A0A2Z5DYC1 | 4-68 | None |
| G7IT45 | 9-64 | None |
| A0A396I283 | 1-54 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.