DPCstruct | MC3872
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 269 ± 39 aa |
| Standard deviation of domain lengths | 38.51 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 71.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L0H7Z7 | 1-253 | MENMQGVLPMPTTLPHEQLARQQQYVWRPIVSSPLPCYSAVPIPDTYIIDKLRGFGWRYFGNTQLADCCLWIYSPETTSPIDQDKAA… |
| A0A1M2VWP2 | 27-261 | ESFGIEDGPAPAPTSTRKSVRPRRMIMKLHMDYLCAHSSLFRGLLSGASIFDLAAENPKSGLDSPSLSRQSSASSLRLPCILPSSTC… |
| Q5KEH3 | 336-639 | None |
| A0A507F6I2 | 5-244 | None |
| A0A081CCJ1 | 125-354 | None |
| A0A0B7G0P8 | 75-328 | None |
| E2LXB1 | 7-230 | None |
| A0A165G303 | 13-307 | None |
| A0A4Y7QBZ7 | 16-365 | None |
| S7QF46 | 26-282 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.