DPCstruct | MC38719
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 107 ± 12 aa |
| Standard deviation of domain lengths | 12.13 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 31.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I3H7E9 | 2-105 | RIDRLRKYGIADLLPPLNEIEYLANHWRNAGYVMAGGMGPAPLTSQELIAWQQGSGVELNPWEFYTILGMSRKYIAGFINGSEYGAQ… |
| A0A4R1W8J6 | 1-92 | MMPDNPAPYLTDWLIEIGPAAPGGDPLGWRDLAAWQDITGIELEPWEGRLIRRLSTDFVSQRHKAEKADCPPPYTGIEDDIPAMRQR… |
| A0A4Q3QHH1 | 1-108 | None |
| A0A3G6WFJ2 | 211-329 | None |
| A0A5B9YXH5 | 9-134 | None |
| A0A7W7K9Z7 | 3-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.