DPCstruct | MC38713
Metacluster Properties and Pfam Annotations
| Number of structural domains | 96 |
|---|---|
| Mean domain length (aa) | 239 ± 31 aa |
| Standard deviation of domain lengths | 30.56 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 15.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08759 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q0M2V4 | 18-255 | KVLGYGPVTEMLRKAADEIHPFSFIRLGHCEPRILGFPDIYGRKDVDRSLRRQFGRKNILNEDLIKIRGDMREAVVNADLIGIGIKE… |
| A0A4V2R859 | 109-333 | ISRYQEHAIPLLLPEQVRDTILQAMDEKQPLSIVRLGDGELLTMAQEIVMPVDQVRKEGRFLDYAGVKVPDLDTRNKLAEAVARADI… |
| B0ULW3 | 266-556 | None |
| A0A514KN73 | 172-433 | None |
| A0A0R2FRL9 | 331-575 | None |
| A0A558HQ78 | 257-543 | None |
| A0A6P1AD90 | 14-248 | None |
| R7BKA6 | 67-347 | None |
| A0A0D8CFI3 | 84-385 | None |
| A0A0F3H4R1 | 802-1040 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.