DPCstruct | MC3871
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 225 ± 25 aa |
| Standard deviation of domain lengths | 24.52 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 71.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12955 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A427Y8B6 | 216-421 | TKAAAALGHELSCLTALAESIPWVDKLRHSTKWDAITISGLRQVPHGSEEWEMGRKGVQAGLEAVNDHPQLPPLLVIILPSSHKTLS… |
| A0A1M2VVQ1 | 1-247 | MDRAHHVYSYVYEAQEHAFDKPKRQLDAFSVPASGAMTAVGELEAFMDFLDNKELPVDRFGAFDLSRLEDLRETFGKDSDQYRTAIQ… |
| A0A4P9X698 | 272-514 | None |
| A0A507DE36 | 205-378 | None |
| A0A146IE08 | 587-814 | None |
| A0A3N4I5K5 | 3-238 | None |
| M5E6Y1 | 152-387 | None |
| A0A0C3NN74 | 130-375 | None |
| A0A1Y2FMP8 | 197-386 | None |
| A0A2N5SFJ6 | 231-473 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.