DPCstruct | MC38707
Metacluster Properties and Pfam Annotations
| Number of structural domains | 136 |
|---|---|
| Mean domain length (aa) | 119 ± 24 aa |
| Standard deviation of domain lengths | 24.09 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 81.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 44.80 |
| Pfam Score | 99.37 |
| Assigned Pfam label(s) | PF02138- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815YM49 | 26-113 | TLESDYVSAHLHEWIDLIFGYKQTGQAAIEAFNVFTYCLYQDAVDVDAIDDKVTREAIESMMQHFGQVPSQLLTEPHPQRQILGQAAF |
| H3G5Y7 | 242-358 | NKLELGTRQNSVGVSDVVLPPWARSPEDFVMKNLVALESEYVSANIHRWIDLVFGCKQRGTAAVEANNVFFYLTYEGMVDVDSITDP… |
| R1GWC0 | 396-489 | None |
| A0A1I8FKS0 | 249-335 | None |
| A0A5K1JRR4 | 257-344 | None |
| A0A183MHP7 | 442-558 | None |
| Q19317 | 1993-2108 | None |
| A0A835R584 | 124-227 | None |
| A0A821PKJ0 | 422-558 | None |
| A0A6V7QYM3 | 530-660 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.