DPCstruct | MC38706
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 77 ± 9 aa |
| Standard deviation of domain lengths | 8.82 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 42.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10683 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815Y7L2 | 9-82 | TTPIPSKLKLRVTQACTEFCAVDGRAFDVITDDDFQNFAKVLFDAGRSLYKSSIEIKELLPHSTTVSRNVTRLY |
| A0A821YHD8 | 13-77 | VTQACTEFCATDSRAFNLITSDGFQNLANVLFDAGRSMYKSSIQIKDLLPHPTTTSRNVSRLYEE |
| A0A814S6Z9 | 54-131 | None |
| A0A820P0N3 | 27-98 | None |
| A0A817YHI9 | 17-99 | None |
| A0A821HZ56 | 31-92 | None |
| A0A821JE75 | 7-74 | None |
| A0A815FTQ9 | 67-161 | None |
| A0A820E7R2 | 2-87 | None |
| A0A817TNN0 | 54-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.