DPCstruct | MC3870
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 364 ± 39 aa |
| Standard deviation of domain lengths | 38.95 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q9MJR3 | 72-434 | CDEACQLADFKARHKRECANFVNPPTTSSFLTTPVAGARYPQHPVFAQGHEDGVGCWVSVAGRIDCDLGALSEPVDPAADIEKRQIQ… |
| A0A1M2VT23 | 1-315 | MAFQSEPDPEERFPHHPVFAHGYNDNVGCWATIEGRMDGQLECLMDTLDPEALGNRYVRTMTGTAASASHEIIRANRAYGRSLLTLR… |
| A0A4Q9MHU6 | 64-425 | None |
| A0A6A4HWB3 | 36-485 | None |
| A0A6A4HS79 | 146-525 | None |
| A0A5C3Q1M1 | 61-405 | None |
| A0A067MRB1 | 55-436 | None |
| A0A2G8SPL1 | 155-531 | None |
| A0A2G8SPG9 | 72-429 | None |
| A0A371DXZ2 | 68-466 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.