DPCstruct | MC387
Metacluster Properties and Pfam Annotations
| Number of structural domains | 117 |
|---|---|
| Mean domain length (aa) | 76 ± 12 aa |
| Standard deviation of domain lengths | 12.42 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 33.80 |
| Pfam Score | 96.97 |
| Assigned Pfam label(s) | PF05717- CL0036- PF07929 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9RBX6 | 2-64 | FAFPAAVDLRKGYDGLYGLVETGLKQDPMSGDLFLFVNESRKLCKVLVWDGSGLCIFQKRLVI |
| A0A1H2Y3B0 | 3-74 | LACGSTDMRKSIDGLAARVQESFRLDPFSPALFAFCNRERDKLKLLYWEHNGFWLYYRRLERGRFWWPDTSD |
| A0A355RKT2 | 6-102 | None |
| A0A7M3PQ71 | 115-186 | None |
| A0A511SWR7 | 6-100 | None |
| A0A1Y6CDS5 | 181-272 | None |
| X6JAW2 | 2-78 | None |
| A0A7W3KYN0 | 78-143 | None |
| A0A4Q2XTC1 | 49-128 | None |
| A0A7K0KDP3 | 2-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.