DPCstruct | MC38698
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 183 ± 25 aa |
| Standard deviation of domain lengths | 25.39 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3QW67 | 10-193 | HTGDPERDLAYEREHVRRDTMSDEVVPDDVAQYLIYFKRMIDEENVVEIHNLYEHGFPDLTERYFQQRLWPNEEAVENIVGSDSRIF… |
| A0A0X3P9L8 | 14-171 | KTLCEDVKTFITSFYQHIKTNNLVEIENDYAVKFPKLTEQYFKSTRWPAVEIIAPLVNKDPWFMMLYNELYYRHLYAHVSSFPDFEE… |
| A0A086L4V3 | 16-239 | None |
| A0A0V0XVW1 | 33-198 | None |
| A0A4Y7NGR5 | 1-247 | None |
| A0A2J8A3H2 | 11-161 | None |
| A0A1Q9D3G5 | 604-783 | None |
| A0A453EHS7 | 39-209 | None |
| A0A453EHT0 | 2-148 | None |
| F0WLC0 | 8-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.