DPCstruct | MC38697
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 194 ± 14 aa |
| Standard deviation of domain lengths | 14.15 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 75.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3QT04 | 37-224 | QRDYVFDFSKYRTSASQLFHDRHRWFELTSNNAFLEFLLQVPLAVTEAAGDSRRIIDIRLKTHCHNLINTTSDMIIFEFADYIAKAE… |
| A0A7J8Y3K2 | 1-154 | MFINVQELEKSLKATCEEFIMAVTKQIVDPMLSFVTKVTAVKVALSSSTQNKKVDSVMAKPLKEQAFAAPEKVAELVQKVNSAIQQE… |
| A0A7R9TL07 | 1-197 | None |
| A0A7S2SLN9 | 89-314 | None |
| A0A167CGJ2 | 689-876 | None |
| A0A8B6BSA0 | 273-466 | None |
| A0A8B6HA91 | 122-310 | None |
| A0A812XMR0 | 103-295 | None |
| A0A4S4KX05 | 66-280 | None |
| A0A287WP83 | 12-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.