DPCstruct | MC38691
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 189 ± 19 aa |
| Standard deviation of domain lengths | 19.01 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.30 |
| Pfam Score | 85.58 |
| Assigned Pfam label(s) | PF01017- CL0073- PF20979 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3QIF8 | 1-176 | LAAENIRVLADGFASARELTDFNLRTSLGPQISGHVAQTTNLNSILDNLTKLLCMLVSQSFIVAIQPEPVLKTQHKFLAEVRLLIGD… |
| A0A821RS44 | 80-260 | LRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDLLQTWCEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEELLAELNATITDIISA… |
| A0A6V7VGR7 | 108-299 | None |
| A0A1E1MX08 | 226-419 | None |
| A0A0G2JX93 | 604-771 | None |
| A0A4W3H9V8 | 211-397 | None |
| A0A5E4AUQ4 | 1-151 | None |
| A0A835NJ91 | 201-397 | None |
| A0A6I8PQY1 | 421-623 | None |
| A0A402FQZ0 | 165-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.