DPCstruct | MC38690
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 75 ± 8 aa |
| Standard deviation of domain lengths | 7.53 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 36.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0644 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N2LD97 | 63-138 | DTLRSQVQQAIPFMVGCPACLRNFLNLFCELTCSPHQSTFINVTTTAKVRGNLTVSGIDFYASDAFGEGLYESCKD |
| A0A0R3QHI7 | 1-77 | MTLPRQFLSRCPSCLTNFVQLWCDFTCSPNQANFVRVIASTDDLHLVENKTQYVTEVAYYVRDSYADGLFQSCKDVS |
| A0A0N4WGK0 | 27-112 | None |
| A0A0A0KE30 | 5-65 | None |
| T1L5T0 | 49-128 | None |
| A0A194Q473 | 177-252 | None |
| A0A0R3TW39 | 9-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.