DPCstruct | MC3869
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 293 ± 25 aa |
| Standard deviation of domain lengths | 25.36 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M2VSE2 | 36-343 | KQWAGYVAEHPIPAPRLVLARILVGASKGAESTKKRTPAQAADAIISAFTTHFETLEFPQLENEVKFFLQLIMVCAEEHRPFVRAFL… |
| A0A2G8SST7 | 171-460 | TLTVCFRNWMHATSSLDIAVNSTLICSFLDEQHVPRYWKSYLASHPLPSLRHLIPRIVRGATVYYVEHGPRERKRNPQQAAEAIVGA… |
| A0A0C3BAS5 | 174-472 | None |
| A0A1Y2IED7 | 155-439 | None |
| A0A4Y9YCL3 | 580-892 | None |
| A0A0C3BJV4 | 21-281 | None |
| A0A5C3PC27 | 1-256 | None |
| A0A5E3WQM0 | 1-352 | None |
| A0A371DL24 | 256-527 | None |
| A0A1M2VSP3 | 3-298 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.