DPCstruct | MC38684
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 291 ± 33 aa |
| Standard deviation of domain lengths | 32.50 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 72.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 26.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00858 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B1TCQ7 | 1-298 | MVRVRRANPRIYEKILSQYEGIMAVYSMCRCVGKAGCVAIKEKKVLNTSDACICFYNKKNDQLWPCYEQTHWEERRCSRCNSFGDCN… |
| A0A0R3QAK1 | 1-305 | LCFILFLYQTYWTLWEFFQYRTIIEMQLEFEPAPFPAATLCNLNAFKNSELRKYEAISEGLDVWEEKINRYKGSKTSYANNSSRKTR… |
| F1L8J3 | 1-272 | None |
| A0A2I0U0G1 | 676-1039 | None |
| A0A1Y3ELX9 | 22-294 | None |
| A0A0B2W4G9 | 112-407 | None |
| H3E1W5 | 206-451 | None |
| A0A0B1TJ88 | 1-255 | None |
| G0P5T5 | 30-301 | None |
| A0A183J7B0 | 30-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.