DPCstruct | MC38680
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 112 ± 6 aa |
| Standard deviation of domain lengths | 6.22 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 39.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01384 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D8XLP1 | 137-242 | NIVISWVLSPLLSGTASVILYMIVDFSVLRRKHPLDCGLRVLPIFYSICVGFISFMVIWDGSKLLHFNELSIWAAALIAIGFGLTTA… |
| A0A7R9HC87 | 72-178 | AMIVASWFVSPVLSGIMSVILFSLIRRFILSAPQPIKPGLHALPFFYGVTIIINVFSIVQDGPKLLYFDVIPWWGALVISLGIGLIV… |
| A0A3P7E6S4 | 81-189 | None |
| T1GYP7 | 72-193 | None |
| A0A183CTS2 | 47-152 | None |
| A0A7R9QKE2 | 3-118 | None |
| A0A2A2JA77 | 156-274 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.