DPCstruct | MC3868
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 76 ± 9 aa |
| Standard deviation of domain lengths | 9.46 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.65 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 46.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10164 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R0RUK2 | 207-282 | QHTGYSQHPQMMMQPQHTSGSQYQQELWARCARGEHDVVVKHGIVGIILAVILFPIGLICLFMDVEKKCSRCGALI |
| A0A1M2VQN0 | 1-62 | MSANVGKQYQDNLMAMCASGNHDVSKKYGVCGIICAVLLFPCGLICLFSDVEKRCVRCGAKV |
| A0A4S8L4B0 | 2-76 | None |
| V2WYR7 | 385-455 | None |
| V2WIR3 | 27-117 | None |
| A0A0C9YD40 | 17-92 | None |
| A0A0C3CSL7 | 31-115 | None |
| A0A2G8RMV3 | 2-63 | None |
| D8PT71 | 20-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.