DPCstruct | MC38679
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 120 ± 23 aa |
| Standard deviation of domain lengths | 22.92 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 45.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5SR19 | 115-205 | IEEWIVVRRGWLTRGFLDALTLGGPGGAPKPIELQAHDPLRYVGDMLAWIHQALPSEREAAQLLFSKCVDIDASEQVQQTISGVSES… |
| A0A453IKZ9 | 43-200 | MDMMSVYQEGAYERLCRWVQVECKKPGDTDNPEVSELLKKAVRCLKERPVLFKYCAEEVANMRHHALFRQFISALTRGGPGGLPRPI… |
| A0A5N5QRZ6 | 442-544 | None |
| A0A507D9S4 | 814-921 | None |
| A0A132ACB3 | 1-147 | None |
| A0A445M3D5 | 198-303 | None |
| I1BHI8 | 2-149 | None |
| W2Z4Y4 | 249-359 | None |
| A0A820ZJK9 | 1-98 | None |
| A0A6I9YAY3 | 2-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.