DPCstruct | MC38678
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 89 ± 9 aa |
| Standard deviation of domain lengths | 8.76 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 41.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16540 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7MKG1 | 37-146 | ILNRPAAVNPRHHRRSKSAGGSKAVWLEHKEVFAAPLGTILTPSIKARKSATQFELKDTLVATDYLLHHQTTDPEGNVETQLFKGSI… |
| A0A0R3Q8G2 | 1-91 | MVCFALAKTRTGYYNARFHRRSKSANSRVIDHQPRNRIPEGTILQPRMPKFSKTRNKLSAEELKKCSNYVLTHQEIDKEGCLTTQVV… |
| A0A7J7KRV8 | 7-92 | None |
| E9IKK0 | 1-78 | None |
| A0A0J7KAF9 | 245-328 | None |
| A0A2A4IUE1 | 44-129 | None |
| A0A182M880 | 1015-1102 | None |
| A0A2H1CE82 | 334-424 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.