DPCstruct | MC38676
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 179 ± 51 aa |
| Standard deviation of domain lengths | 50.92 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 83.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 45.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S4PL68 | 16-160 | MNAVVLYVGTQAIAHIRSKGQTPNMTTIAHSAHMDIFQNFTVDFDYEGRYLFLNAIANQLRYPNSHTHYFSCCLLYLFAEANSEAVQ… |
| A0A812Z2L9 | 1-146 | MYVAAYAVGQQQQQKTQVPLSVAMDIYKYLVTNLDAEARYGLFNIMANQLRYPNNHTHFFSCVLLSLFADADTEFIQEQITRVLLER… |
| A0A1I7ZGD4 | 1022-1205 | None |
| A0A813G041 | 45-232 | None |
| Q7RM05 | 26-152 | None |
| A0A843WGC8 | 160-300 | None |
| A0A1I7SA09 | 4-113 | None |
| A0A3P7MQJ6 | 258-446 | None |
| A0A5B7CPH8 | 176-412 | None |
| A0A0R3Q651 | 95-291 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.