DPCstruct | MC3867
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 166 ± 18 aa |
| Standard deviation of domain lengths | 18.06 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M2W1I6 | 2-147 | NAITVYAKERGRAPSDMPRRTRIRDVVSLDIVIPPVVPLQIGQRVCVQVLRRRRSRNGSLAAGYECEPIGVEGTIVGVRTMELAVTE… |
| A0A1M2VMG5 | 2-169 | PTTQATIIYALERGRVPTSMPRSSRILENVNFDVAIAPPVPLRIGMAVDIHVLRRITPQAYNNEEEETRYAAEPADITGTIIGIKSL… |
| A0A1M2W222 | 2-166 | None |
| A0A1Y2I844 | 3-125 | None |
| A0A5C3PUS0 | 8-181 | None |
| A0A5C3PRN7 | 4-180 | None |
| A0A5C3PHT5 | 35-212 | None |
| A0A1M2W5P8 | 22-189 | None |
| A0A4Q9QDP8 | 74-244 | None |
| A0A371DJZ5 | 37-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.