DPCstruct | MC38669
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 137 ± 9 aa |
| Standard deviation of domain lengths | 8.96 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 28.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M6WCC7 | 1-135 | MLVLHVLGVLAICIPLWIMAPKSNASETIINFTSNGGWQDLDLASTTGVVPMIGMLIGYDCCVHMSEEVRVASRTIPAVIIWAVISN… |
| A0A421D7H2 | 182-321 | LVALLFNTLLAQKLPLIEGIILVIHCFGFFGILIPLWVLSPRPAASEVFGSIEDRGGWGNNGLACLVGLVGPIYALIGPDSAVHMSE… |
| A0A4U0WXC1 | 141-261 | None |
| A0A819DA77 | 89-216 | None |
| A0A0F0IM88 | 810-950 | None |
| A0A2B7YZH6 | 179-324 | None |
| A0A0D0AAF0 | 57-193 | None |
| A0A4V5NBA4 | 2-139 | None |
| S7PT63 | 26-164 | None |
| A0A1R3RL85 | 3-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.