DPCstruct | MC38664
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 269 ± 38 aa |
| Standard deviation of domain lengths | 37.84 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 18.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S6G8W1 | 31-277 | SKSTKDIQLQIPRNHEVYKDVNDRTEEIFRSLNKILFGDNEAEKIKYLTTQKEENSKEFIKKSNELKAKYLETKSEESIKELKEFYS… |
| A0A0F5H293 | 4-265 | KELAYKENDFDIFVQQNYINEILNIIFSNDNEAKKLYIESQKQLNNSYLLQVKEALRYANHITYSLNSTRNSFLALYDKAYTVKKAE… |
| A0A3G8LGP5 | 42-325 | None |
| A0A449B4U9 | 1-338 | None |
| A0A0L1IJ96 | 32-271 | None |
| E4PSN7 | 2-254 | None |
| N9V1P3 | 17-307 | None |
| A0A501XB98 | 1-298 | None |
| A0A7U3ZSD5 | 27-276 | None |
| A0A1D5B5K6 | 21-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.