DPCstruct | MC38662
Metacluster Properties and Pfam Annotations
| Number of structural domains | 96 |
|---|---|
| Mean domain length (aa) | 160 ± 23 aa |
| Standard deviation of domain lengths | 23.07 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0570 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P6NYU2 | 2-160 | TTVVAERHQQNVPAGFKLTEEQPNQQEELTAVIHLKQENKEELKNKLDAVSDPKSSEYGKYLTREQVEAMTAAKPEHIDAVKSWLSK… |
| R8BFN6 | 1-125 | MTLQVGLKLQNIDQLEAKLKAVSDPTSPDYGRYLDAAEVNAIFSPANDSRVAVHNWLRKAGVSEIADFGSYINFAASIGTANRLLGS… |
| A0A0C3C3Z9 | 34-141 | None |
| A0A1V8SN43 | 465-600 | None |
| A0A4Q9MLU0 | 2-121 | None |
| A0A545UYZ6 | 17-200 | None |
| A0A838UPT5 | 26-219 | None |
| A0A4S9VZM0 | 639-821 | None |
| G7TIL0 | 15-198 | None |
| A0A146I3Y2 | 606-765 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.