DPCstruct | MC38661
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 378 ± 93 aa |
| Standard deviation of domain lengths | 92.64 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 74.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05502 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2UH53 | 6-464 | LYVDHAGHPAPLSLCYHATASRLLSSSIEHRAPPSTTTEVDSAYCPQCLTFHDAASALMLGRCPKPHCRSCPLCEAVLSIAILDDDD… |
| A0A2P6NU08 | 23-398 | LYLCHKCAKLKCTECTTQEIDSFFCPQCMENMSSSEVTHFRNSCKKCFECPSCFSILSYHVQADISGKSDIDSDPDGGKGEEDKALV… |
| A0A5J4NUS4 | 11-310 | None |
| A0A653DTB7 | 1-438 | None |
| A0A0R3QM79 | 37-405 | None |
| A0A3L8DYK1 | 1-251 | None |
| A0A654H9R0 | 220-605 | None |
| A0A4U0VZZ5 | 1-571 | None |
| A0A817QF72 | 1-294 | None |
| A0A1X2IIP7 | 2-420 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.