DPCstruct | MC3866
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 226 ± 18 aa |
| Standard deviation of domain lengths | 18.29 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.40 |
| Pfam Score | 79.70 |
| Assigned Pfam label(s) | CL0125- CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G8SD98 | 140-357 | TMYHLPVELYIQCLVQLPGREPSSLHAVVSFLSANSVTRAAALDRPVWANLYRSRYTHNVAEREEERLTRHAGDWQMIFIERYKLDR… |
| A0A1M2VKS0 | 1-213 | MGVGHKLPQLPLEVYTEAFTYLFSFGGNMSLMTLLSLLATSRHIRTAASPNVIWRPYYRVHYTHSVWAHEKWRHAHYHGDYRLQYFA… |
| A0A4R8Q6P0 | 1-213 | None |
| H0ENB3 | 295-519 | None |
| A0A4Q9N6F3 | 1-223 | None |
| A0A370TDC8 | 657-894 | None |
| A0A2C6A5E0 | 6-238 | None |
| A0A4R0RAQ0 | 4-251 | None |
| A0A4R0R7E9 | 1-259 | None |
| A0A484FA80 | 1-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.