DPCstruct | MC38659
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 133 ± 29 aa |
| Standard deviation of domain lengths | 29.01 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 80.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 32.76 |
| Pfam Score | 98.44 |
| Assigned Pfam label(s) | PF04699- PF15070 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B0E674 | 8-135 | VDYTTAVEKHVEIADQVIKGGINIEEGLKEMLDVIPLGCKDTPILEKNAEAILSVLASVKEVKESYVSTLSIEQQSWLMMYVYKGLG… |
| A0A2P6NM00 | 43-176 | MSEEYEGQQSTKTDAQWSSEISGREKAVQQQTNVGNIAGALDQALQDPPYNAGEAVRTKNAALVVSVLSAAKEKDIDGIVSKLSDDN… |
| A0A5B8MT64 | 4-117 | None |
| A0A2S5B0I6 | 6-154 | None |
| G3HZI0 | 171-246 | None |
| A0A167EDU0 | 75-248 | None |
| K7HI53 | 2-83 | None |
| A0A836ASD7 | 5-175 | None |
| J9JPQ6 | 23-151 | None |
| A0A2C6A8K8 | 65-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.