DPCstruct | MC38658
Metacluster Properties and Pfam Annotations
| Number of structural domains | 77 |
|---|---|
| Mean domain length (aa) | 226 ± 36 aa |
| Standard deviation of domain lengths | 36.29 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.63 |
| Pfam Score | 89.47 |
| Assigned Pfam label(s) | CL0123- CL0335 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E7WVG8 | 14-213 | PSPRLRVWHGISALAIILLFLAMHMTNHLAGLLGEAQHRQLMDIFRTIYRAHLVEPLIVALFLFQVVSGLAMVRAHSTRPADFFRSL… |
| A0A2P6NL41 | 4-229 | SKPIFNIPEPLLVKIQAASGLCFGSFLFIHLINTSSAHFGQLAYDGSQAFLRAYYQNPLLEPVVVFGSLTVHSVSSAFRYINRYRSE… |
| A0A7V8VHT3 | 26-247 | None |
| A0A7S2VRF0 | 469-696 | None |
| A0A7J6L573 | 133-356 | None |
| A0A7J6KZX3 | 520-741 | None |
| A0A7J6KQZ7 | 725-936 | None |
| A0A7W7ZIE7 | 83-277 | None |
| A0A2T4CEC5 | 2-247 | None |
| A0A2H4SHY1 | 250-515 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.