DPCstruct | MC38656
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 155 ± 20 aa |
| Standard deviation of domain lengths | 20.40 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05068 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3XUW9 | 99-254 | ARRDLQTLPHLTADACRLVDDLQKETDRGAALLGAAFLDDVLDVMLRSAFVADGDAVNKILGAGRPLESFGARAHLAYCLGLLAPDV… |
| A0A086H3Q8 | 42-196 | MADEERSQFLKDLNAESPLELVIRAHLWIESRMIELLCDLVPFPDRIDFDRFTFPQKVTLVAAHGALNKEDIPAYLKLNSMRNKVAH… |
| A0A1G0R1N3 | 15-164 | None |
| A0A5C7UBW1 | 25-176 | None |
| A0A0G0XDW8 | 2-134 | None |
| A0A244C440 | 11-163 | None |
| A0A650F5R5 | 27-186 | None |
| F8GFL3 | 11-180 | None |
| I1DWZ0 | 85-238 | None |
| A0A7Z0G8Y8 | 16-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.