DPCstruct | MC38655
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 107 ± 5 aa |
| Standard deviation of domain lengths | 4.96 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 24.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A838UF31 | 3-119 | EFPQELQRLPLPPMPAVFERALGYGRNARYLVLYWDPCGDEVTWDDGEMLTQGNWQSFLVFVNHAAIAPVLDGYDLGGSDAPARDGL… |
| A0A7C3TTH8 | 24-126 | FVRLSDCLQQSIDRDLGYHGEDRFVFFHYEPRGGEVMWHDRHSYGFAAGGWRAYFEDIEPLGDRYGVDLSGAGEPPRYGLLVDRARR… |
| A0A6N6KWL2 | 10-116 | None |
| A0A3C1RVS2 | 5-107 | None |
| A0A2Z3HCW1 | 2-110 | None |
| K9VTM5 | 6-115 | None |
| A0A323U2Y5 | 27-135 | None |
| A0A6P2CRQ4 | 5-103 | None |
| A0A7Y3NSY3 | 21-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.