DPCstruct | MC38650
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 167 ± 10 aa |
| Standard deviation of domain lengths | 10.21 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.33 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0369- CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E3IIA7 | 12-172 | FLVAEATIAAEKAKPLYISPIVTAQTPGHAVSMDVDLKGSRSLFLVVDETGDGYGCDWADWIEPRLVGPKGTLKLTDLKWKAAFAGW… |
| A0A3C0ELD6 | 125-293 | AKHLWYQVVADGQTLVDDKTGAWLLGARDINVDITGKKILTLKTKIDPKKRYRNKSIFWGDPAIITAEGKTLYLADLKIQSDNIVAT… |
| A0A2E8MA15 | 10-197 | None |
| A0A831XTW6 | 355-511 | None |
| A0A1W1W627 | 14-174 | None |
| M5S9D4 | 5-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.