DPCstruct | MC3865
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 292 ± 53 aa |
| Standard deviation of domain lengths | 53.33 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 72.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20153 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H3D218 | 16-321 | DYEQRYPEVPPGSECGPMARIWRIFLDECQEFDAGRIEILRDSVDVLLVFAGLFSAAVTTFVAQMSQSLQTDYMRISASLLYESVSI… |
| A0A1M2VJ61 | 3-287 | KRWNAEIDTYLTFAGLFSGVLTAFNVQSYLLLQPATPDPTLLALQQISLQLSSFSTGPPPAFVNSTHPAFQQGITLPPPIPRTAVWL… |
| G4TQX3 | 27-321 | None |
| A0A5C3M4Z1 | 57-318 | None |
| A0A4Q2DQR4 | 37-374 | None |
| A0A4Q2DPN0 | 1-291 | None |
| A0A2G8SB96 | 7-275 | None |
| A0A164MK30 | 89-355 | None |
| A0A0K6GFC2 | 40-328 | None |
| A0A4Y7TFC6 | 16-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.