DPCstruct | MC38648
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 172 ± 15 aa |
| Standard deviation of domain lengths | 15.03 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B1T658 | 313-476 | QTKATTDKCDSTVESLKTLRLRVYNSQKERKAKRIHGFGASDPPQSGAFYLKPNEICKGGDLRDLYTRLKSTRQVLSDSQEISFFNC… |
| A0A016U8Z4 | 1-191 | MAHQINVSMTLLTRSAETASSLQRQLTQEARRRVRIYADHFGSPDYKPAAGEYAIPESRFGPGCSLAEVYLGLQNSETFPKVVNEMD… |
| W2SRU4 | 104-277 | None |
| A0A183FBG9 | 1-179 | None |
| A0A016U833 | 374-564 | None |
| A0A016VK53 | 122-304 | None |
| A0A016SA17 | 1-165 | None |
| A0A183GIG1 | 41-229 | None |
| A0A183FWF2 | 117-272 | None |
| A0A183GQ56 | 15-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.