DPCstruct | MC38647
Metacluster Properties and Pfam Annotations
| Number of structural domains | 391 |
|---|---|
| Mean domain length (aa) | 75 ± 12 aa |
| Standard deviation of domain lengths | 12.28 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 28.43 |
| Pfam Score | 99.27 |
| Assigned Pfam label(s) | CL0010- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A016U697 | 4-71 | RSSASANATADEEECEAYTVEKILKTRKRGGRREYLIKWEGWPLDQSTWEAESDCDCEEAIKQFYETS |
| A0A1I7SS50 | 6-58 | KKYPVERILKHKEINGVRWYLIKWEGYPIHRSTWETEDYLDECRETLMDYQLR |
| A0A2D4FGQ6 | 1-67 | None |
| G2YYN2 | 230-308 | None |
| I1CW37 | 173-243 | None |
| I1CRV9 | 111-179 | None |
| A0A226EV88 | 264-343 | None |
| A0A226EKD9 | 73-160 | None |
| K3WDT0 | 41-162 | None |
| A0A7R9AA08 | 193-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.