DPCstruct | MC38646
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 92 ± 4 aa |
| Standard deviation of domain lengths | 4.35 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 30.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05649 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A016TSV5 | 1-99 | MLDNMSELFGRVSLYSVVHRFVCKVNWTKYLLKTVPAIHHSYIINDPIVIAAKTQQETINSILLSTRKEVIVNYAMLLYTLSWIEYM… |
| A0A183F8T1 | 46-131 | MLFRLSQLDREIKSIKWTKLFSLIAPEEAKQYVMSDPVVAVTNITFLKMIDQVLSETPTRVLTNYVIMRFVISWAEALDGRYRRAI |
| A0A0M3HIF3 | 1-91 | None |
| A0A3P7Z2K0 | 52-139 | None |
| A0A0K0DLT5 | 138-227 | None |
| A0A6V7YAN8 | 94-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.