DPCstruct | MC3864
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 115 ± 8 aa |
| Standard deviation of domain lengths | 8.46 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 32.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A409WH89 | 302-420 | QHLTVLAPFMAPLFDAMTARDLRRRFSAPRALEFFEEMVSQMSRQELETDIRGVEPQGHVPYDEYNRWKDIPISLVRQWTIYREPPL… |
| A0A1M2VGS4 | 4-111 | IPLLAPLISRMTTHVIDDQWSAEEAFVFFSDILAGLSPDTLDSCVSLSWDRGPIDNPDLYWSRLSPEFQSSWNTHRSPPISLFTRAL… |
| A0A4Y7Q9U5 | 117-242 | None |
| A0A0C9WRL1 | 59-178 | None |
| A0A0D7A703 | 75-194 | None |
| A0A1C7MLA3 | 392-504 | None |
| A0A0C2YJA4 | 209-319 | None |
| A0A4Q2DLT2 | 632-748 | None |
| K5XFN0 | 2-107 | None |
| K5X3G8 | 829-933 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.