DPCstruct | MC38639
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 72 ± 4 aa |
| Standard deviation of domain lengths | 3.79 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 69.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 46.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05142 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N2MDJ6 | 140-209 | AGLEIENFPAEVNSTVTFRCFRVSSIDESIDQFAYQTSVNIGGRVFKGILYDQGPHESRYYFGESSSRQL |
| A0A803PFJ0 | 74-143 | LEVGNFPSEVNSQAVFRCVKVSSMEDNDDQYAYQTAVNIGGHVFKGILYDHGLETNYNNMVGETSSGGGG |
| A0A7J7N097 | 197-270 | None |
| A0A0D3D355 | 1-69 | None |
| G7JIL8 | 87-155 | None |
| A0A2P6PPR9 | 93-171 | None |
| A0A7J6FXI4 | 100-176 | None |
| A0A2I0VXS7 | 131-201 | None |
| A0A4P1R7G7 | 437-503 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.